PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0661.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 189aa    MW: 21260.7 Da    PI: 6.631
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0661.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.51.5e-2071131257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          r+R+t+t++ql++L +++e+ + +p++++++e+A++l    ++te++V++WFqNrRa+ k+
  Bostr.7128s0661.1.p  71 RHRWTPTSTQLQILDSVYEEgSGTPNRRRIREIATELsehgQITETNVYNWFQNRRARSKR 131
                          89*****************99**************************************97 PP

2Wus_type_Homeobox99.62.4e-3270133265
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          +r+RWtPt++Q++iL+++y++G  tPn+++i++i++eL+e+G+i+++NV++WFQNr+aR+++kq
  Bostr.7128s0661.1.p  70 SRHRWTPTSTQLQILDSVYEEGSGTPNRRRIREIATELSEHGQITETNVYNWFQNRRARSKRKQ 133
                          689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-1664136IPR009057Homeodomain-like
SuperFamilySSF466893.29E-1864136IPR009057Homeodomain-like
PROSITE profilePS5007114.52867132IPR001356Homeobox domain
SMARTSM003898.2E-1369136IPR001356Homeobox domain
PfamPF000463.5E-1871131IPR001356Homeobox domain
CDDcd000865.36E-1275133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0051301Biological Processcell division
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MEREIQNGAY HGRVMTEEQM EILRKQIAVY AVICDQLVLL HNSLSSGMRP MVGGYFDPMG  60
SSSSSHRISS RHRWTPTSTQ LQILDSVYEE GSGTPNRRRI REIATELSEH GQITETNVYN  120
WFQNRRARSK RKQSQTTTTN GQADDVAVTK EERSCGDSGG LESYEHILFP SPDLGIEHLL  180
SIGKFLES*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124132RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412970.0AJ441297.1 Arabidopsis thaliana mRNA for homeodomain protein PALE-2 (pale-2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002890403.11e-127homeobox-leucine zipper family protein
RefseqNP_173493.21e-127WUSCHEL-related homeobox 14
SwissprotQ9LM841e-129WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLD7KJ491e-127D7KJ49_ARALL; Homeobox-leucine zipper family protein
STRINGfgenesh1_pg.C_scaffold_10018811e-126(Arabidopsis lyrata)
STRINGAT1G20700.11e-126(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122111732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.11e-119WUSCHEL related homeobox 14